Gene Mb0584
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0584, -, len: 88 aa. Equivalent to Rv0569, len: 88 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 88 aa overlap). Conserved hypothetical protein. C-terminus highly similar to AAA63065.1|U15184|MLU15184_10 hypothetical protein from Mycobacterium leprae (53 aa), FASTA scores: opt: 140, E(): 0.0046, (64.7% identity in 34 aa overlap). Also similar to T36824|SCI35.11 hypothetical protein from Streptomyces coelicolor (64 aa); and N-terminus of T36956 probable DNA-binding protein from Streptomyces coelicolor (323 aa). Also highly similar to Rv2302|MTCY339.07c|NP_216818.1|NC_000962 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (80 aa), FASTA scores: opt: 300, E(): 1.4e-13, (61.8% identity in 76 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 662246 | 662512 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0584|Mb0584
MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETDHVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT
Bibliography
No article yet recorded