Gene Mb0588c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | nicotinic acid phosphoribosyltransferase pncb2 |
| Comments | Mb0588c, -, len: 463 aa. Equivalent to Rv0573c,len: 463 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 463 aa overlap). Conserved hypothetical protein, similar to other conserved hypothetical proteins and some nicotinate phosphoribosyltransferases e.g. NP_213718.1|NC_000918 hypothetical protein from Aquifex aeolicus (426 aa); AL109962|T36953|SCJ1.20 conserved hypothetical protein from Streptomyces coelicolor (438 aa), FASTA scores: opt: 1089, E(): 0, (49.4% identity in 385 aa overlap); P_391053.1|Z99120|BSUB0017_57|NC_000964 protein similar to nicotinate phosphoribosyltransferase from Bacillus subtilis (490 aa), FASTA scores: opt: 955, E():0, (43.5% identity in 356 aa overlap); etc. Also similar to Q10641|Y03F_MYCTU|MTCY130.15c|Rv1330c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (509 aa), FASTA scores: opt: 761, E(): 0, (38.4% identity in 437 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 667093 | 668484 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0588c|pncb2
MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTVIFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAHGTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLEQVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDGARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGAKAKRP
Bibliography
No article yet recorded
