Gene Mb0592
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein tb27.3 |
Comments | Mb0592, TB27.3, len: 261 aa. Equivalent to Rv0577,len: 261 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 261 aa overlap). TB27.3, conserved hypothetical protein. Corresponds to O53774|CF30_MYCTU 27 KD ANTIGEN CFP30B from Mycobacterium tuberculosis culture filtrate (260 aa), FASTA scores: opt: 1781, E(): 0,(100.0% identity in 260 aa overlap). Also similar to several hypothetical proteins and hydroxylases from Steptomyces sp. e.g. T35032 probable hydroxylase from Streptomyces coelicolor (263 aa); Q55078 orfA gene product from Streptomyces sp. (275 aa), FASTA scores: E(): 1.5e-1 9, (38.6% identity in 264 aa overlap); D89734_1|P95754 DNA for SgaA SGAA PROTEIN from Streptomyces griseus; and SC9B10_20 from Streptomyces coelicolor (267 aa), FASTA score: (38.9 identity in 252 aa overlap). Also similar to Rv0911|MTCY21C12.05 from Mycobacterium tuberculosis (257 aa), FASTA scores: E(): 1.1e-20, (32.0% identity in 259 aa overlap). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 672409 | 673194 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0592|TB27.3 MPKRSEYRQGTPNWVDLQTTDQSAAKKFYTSLFGWGYDDNPVPGGGGVYSMATLNGEAVAAIAPMPPGAPEGMPPIWNTYIAVDDVDAVVDKVVPGGGQVMMPAFDIGDAGRMSFITDPTGAAVGLWQANRHIGATLVNETGTLIWNELLTDKPDLALAFYEAVVGLTHSSMEIAAGQNYRVLKAGDAEVGGCMEPPMPGVPNHWHVYFAVDDADATAAKAAAAGGQVIAEPADIPSVGRFAVLSDPQGAIFSVLKPAPQQ
Bibliography
No article yet recorded