Gene Mb0595c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0595c, -, len: 163 aa. Equivalent to Rv0580c,len: 163 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 163 aa overlap). Conserved hypothetical protein, equivalent to AAA90989.1|U20446|MK35 lipoprotein precursor from Mycobacterium kansasii (225 aa). TBparse score is 0.910. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 678368 | 678859 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0595c|Mb0595c
MTDQSYAVDIAHPPAALLRLVNPILRSLLHTPLAGPLRTQLMVVSFTGRKTGRHFSIPLSAHVIDNDLYALTEAGWKHNFSDGAAAQVVYDGKTTAMRGELIRDRAVVSELFLRAAQAYGVKRGQRMLGLSFRDRRIPTLEEFAEAVDRLKLVAIRLTPADNS
Bibliography
No article yet recorded