Gene Mb0596
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb26 |
Comments | Mb0596, -, len: 71 aa. Equivalent to Rv0581, len: 71 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 71 aa overlap). Conserved hypothetical protein, showing weak similarity to several Mycobacterium tuberculosis proteins including P95003|Z83863|Rv2550c|MTCY159_6 CONSERVED HYPOTHETICAL PROTEIN (81 aa), FASTA scores: opt: 93, E(): 3.2, (25.7% identity in 70 aa overlap); Rv2871; Rv1241; etc. Also shows weak similarity to X05648|SGSPH_1 from Streptomyces glaucescens (77 aa), FASTA scores: opt: 92, E(): 3.6,(35.4% identity in 65 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 678953 | 679168 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0596|vapb26 MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPPPRGGLYAGSEPIARRVDELLAGFGER
Bibliography
No article yet recorded