Gene Mb0611c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc4 |
| Comments | Mb0611c, -, len: 130 aa. Equivalent to Rv0595c,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Conserved hypothetical protein, similar to other conserved hypothetical proteins e.g. Rv0627 (135 aa) and Rv0665 (112 aa) from Mycobacterium tuberculosis; and STBB_PSESM|Q52562 plasmid stability protein from Pseudomonas syringae (139 aa), FASTA scores: opt: 131, E(): 0.0035, (35.2% identity in 88 aa overlap). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 696084 | 696476 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0611c|vapc4
MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Bibliography
No article yet recorded