Gene Mb0614c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc27. contains pin domain. |
| Comments | Mb0614c, -, len: 137 aa. Equivalent to Rv0598c,len: 137 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 137 aa overlap). Conserved hypothetical protein; similar to Rv2596|Y0B5_MYCTU|Q50625 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (134 aa), FASTA scores: opt: 254, E(): 8.2e-12, (41.5% identity in 130 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 698399 | 698812 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0614c|vapc27
MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Bibliography
No article yet recorded