Gene Mb0615c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb27 |
| Comments | Mb0615c, -, len: 78 aa. Equivalent to Rv0599c, len: 78 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 78 aa overlap). Conserved hypothetical protein, similar to Rv2595|Y0B6_MYCTU|Q50626 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (81 aa), FASTA scores: opt: 160, E(): 6.2e-07, (35.8% identity in 81 aa overlap). N-terminus shows stong similarity with N-terminus of NP_104908.1|NC_002678 hypothetical protein from Mesorhizobium loti (89 aa). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 698809 | 699045 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0615c|vapb27
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK
Bibliography
No article yet recorded