Gene Mb0616c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | two component sensor kinase [second part] |
| Comments | Mb0616c, -, len: 168 aa. Equivalent to Rv0600c,len: 168 aa (probable partial CDS), from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 168 aa overlap). Probable two-component sensor kinase (second part) (EC 2.7.3.-), similar to part (C-termini) of many others e.g. Q04943|AFQ2_STRCO sensor protein afsq2 from Streptomyces coelicolor (535 aa), FASTA scores: opt: 347,E(): 1.9e-12, (33.0% identity in 206 aa overlap); etc. Note that sequence was checked and no errors were detected, which would allow this and the upstream ORF to be joined. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 699149 | 699655 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0616c|Mb0616c
MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ
Bibliography
No article yet recorded