Gene Mb0618c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | two component dna binding transcriptional regulatory protein tcra |
| Comments | Mb0618c, tcrA, len: 253 aa. Equivalent to Rv0602c,len: 253 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 253 aa overlap). Probable tcrA,two-component DNA-binding response regulator, highly similar to others e.g. NP_107959.1|NC_002678 two-component response regulator from Mesorhizobium loti (239 aa); etc. Also similar to many other Mycobacterium tuberculosis two-component regulators e.g. Q50806|MTCY10G2.16|Rv1033c RESPONSE REGULATOR HOMOLOG TRCR (TCRV) (257 aa), FASTA score: (47.4 identity in 232 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 700283 | 701044 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0618c|tcrA
MADETTMRAGRGPGRACGRVSGVRILVIEDEPKMTALLARALTEEGHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARGAVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRVWRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDKIDRPFGVTSLETIRGAGYRLRKDGGRHALPR
Bibliography
No article yet recorded