Gene Mb0625
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc28. contains pin domain. |
Comments | Mb0625, -, len: 133 aa. Equivalent to Rv0609, len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Conserved hypothetical protein, similar to several Mycobacterium tuberculosis hypothetical proteins e.g. YW37_MYCTU|Q10874|Rv1982c|MT2034|MTCY39.37 CONSERVED HYPOTHETICAL PROTEIN (139 aa), FASTA scores: opt: 262,E(): 8.1e-12, (39.1% identity in 128 aa overlap); MTCY20H10.05|Rv0624|MT0652|MTCY20H10.05 CONSERVED HYPOTHETICAL PROTEIN (131 aa), FASTA score: (42.9% identity in 126 aa overlap), Rv0565c, Rv3854c, etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 704731 | 705132 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0625|vapc28 MIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLARAAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Bibliography
No article yet recorded