Gene Mb0633A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB29 |
| Comments | Mb0633A, len: 75 aa. Equivalent to Rv0616A len: 75 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 75 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapB29,antitoxin,part of toxin-antitoxin (TA) operon with Rv0617,see Arcus et al. 2005. Similar to many others in M. tuberculosis e.g. Rv2530A (74 aa) 35.9% identity in 78 aa overlap |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 712027 | 712254 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0633A|vapB29
MRTTIDLPQDLHKQALAIARDTHRTLSETVADLMRRGLAANRPTALSSDPRTGLPLVSVGTVVTSEDVRSLEDEQ
Bibliography
No article yet recorded