Gene Mb0634
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc29. contains pin domain. |
| Comments | Mb0634, -, len: 133 aa. Equivalent to Rv0617, len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 133 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv2494, Rv3320c,Rv0749, Rv0277c, Rv2530c, etc. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 712251 | 712652 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0634|vapc29
MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Bibliography
No article yet recorded