Gene Mb0639
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb30 |
Comments | Mb0639, -, len: 84 aa. Equivalent to Rv0623, len: 84 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 84 aa overlap). Conserved hypothetical protein, highly similar to NP_384911.1|NC_003047 CONSERVED HYPOTHETICAL PROTEIN from Sinorhizobium meliloti (84 aa). Also similar to several Mycobacterium tuberculosis hypothetical proteins e.g MTCY28_2|Rv1740|MTCY28.02|MTCY04C12.25 CONSERVED HYPOTHETICAL PROTEIN (70 aa), FASTA score: (73.5% identity in 68 aa overlap); MTCY4C12_25|Rv0608|MTCY19H5.14c CONSERVED HYPOTHETICAL PROTEIN (81 aa), FASTA score: (73.5 identity in 68 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 717656 | 717910 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0639|vapb30 MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRARVVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA
Bibliography
No article yet recorded