Gene Mb0640
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc30. contains pin domain. |
| Comments | Mb0640, -, len: 131 aa. Equivalent to Rv0624, len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 131 aa overlap). Conserved hypothetical protein, highly similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv1741, Rv0609,Rv2759c,Rv0565c, Rv3854c, Rv3083, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 717910 | 718305 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0640|vapc30
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Bibliography
No article yet recorded