Gene Mb0642
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb5 |
| Comments | Mb0642, -, len: 86 aa. Equivalent to Rv0626, len: 86 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 86 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c,Rv3407,Rv3181c, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 719271 | 719531 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0642|vapb5
MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR
Bibliography
No article yet recorded