Gene Mb0642 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible antitoxin vapb5 | 
| Comments | Mb0642, -, len: 86 aa. Equivalent to Rv0626, len: 86 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 86 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c,Rv3407,Rv3181c, etc. | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 719271 | 719531 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0642|vapb5
MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR
      
    Bibliography
    No article yet recorded