Gene Mb0643
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc5 |
| Comments | Mb0643, -, len: 135 aa. Equivalent to Rv0627, len: 135 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 135 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins Rv0595c and Rv0665. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 719528 | 719935 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0643|vapc5
MSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Bibliography
No article yet recorded