Gene Mb0655
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | (3r)-hydroxyacyl-acp dehydratase subunit hadb |
Comments | Mb0655, -, len: 142 aa. Equivalent to Rv0636, len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 142 aa overlap). Conserved hypothetical protein, equivalent to NP_302286.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (142 aa). Also highly similar to CAB77411.1|AL160431|SCD82.08 hypothetical protein from Streptomyces coelicolor (142 aa); and similar to others e.g. U28943|CELE04F6_3 from Caenorhabditis elegans (cosmid E04) (298 aa), FASTA scores: opt: 167, E(): 0.00064, (31.6 identity in 117 aa overlap). |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 733629 | 734057 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0655|hadb MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVVGLDAAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVFNGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA
Bibliography
No article yet recorded