Gene Mb0659
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l11 rplk |
| Comments | Mb0659, rplK, len: 142 aa. Equivalent to Rv0640,len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Probable rplK, 50S ribosomal protein L11, equivalent to NP_302282.1|NC_002677 50S ribosomal protein L11 from Mycobacterium leprae (142 aa). Also highly similar to others e.g. P48954|RL11_STRCO|SCD82.19 50s ribosomal protein L11 from Streptomyces coelicolor (144 aa), FASTA scores: opt: 763,E(): 0, (84.6% identity in 143 aa overlap); etc. Contains PS00359 Ribosomal protein L11 signature. BELONGS TO THE L11P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 736258 | 736686 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0659|rplK
MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTWDQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE
Bibliography
No article yet recorded