Gene Mb0671
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l7/l12 rpll (sa1) |
Comments | Mb0671, rplL, len: 130 aa. Equivalent to Rv0652,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Probable rplL (alternate gene name: L7|L12), 50S ribosomal protein L7/L12, equivalent to NP_302275.1|NC_002677 50S ribosomal protein L7/L12 from Mycobacterium leprae (130 aa); and P37381|RL7_MYCBO 50s ribosomal protein L7/L12 from Mycobacterium bovis (130 aa). Also highly similar to others e.g. P02396|RL7_STRGR 50S RIBOSOMAL PROTEIN L7/L12 from Streptomyces griseus (127 aa); etc. BELONGS TO THE L12P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 750618 | 751010 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0671|rplL MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVK
Bibliography
No article yet recorded