Gene Mb0675c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc6 |
| Comments | Mb0675c, -, len: 127 aa. Equivalent to Rv0656c,len: 127 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 127 aa overlap). Conserved hypothetical protein, showing similarity with proteins from Mycobacterium tuberculosis e.g. Rv2757c, Rv2546,etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 754753 | 755136 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0675c|vapc6
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVGALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Bibliography
No article yet recorded