Gene Mb0678c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin mazf2 |
| Comments | Mb0678c, -, len: 102 aa. Equivalent to Rv0659c,len: 102 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 102 aa overlap). Conserved hypothetical protein, weakly similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv1942c, Rv1495, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 756454 | 756762 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0678c|mazf2
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRRITRLSPARLHEACQTLRASTGC
Bibliography
No article yet recorded