Gene Mb0678c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | toxin mazf2 | 
| Comments | Mb0678c, -, len: 102 aa. Equivalent to Rv0659c,len: 102 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 102 aa overlap). Conserved hypothetical protein, weakly similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv1942c, Rv1495, etc. | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 756454 | 756762 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0678c|mazf2
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRRITRLSPARLHEACQTLRASTGC
      
    Bibliography
    No article yet recorded