Gene Mb0679c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin maze2 |
| Comments | Mb0679c, -, len: 81 aa. Equivalent to Rv0660c, len: 81 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Conserved hypothetical protein, showing some similarity to AF016485_130 from Halobacterium sp (100 aa), FASTA scores: (32.4% identity in 74 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 756749 | 756994 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0679c|maze2
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAAR
Bibliography
No article yet recorded