Gene Mb0680c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc7 |
| Comments | Mb0680c, -, len: 145 aa. Equivalent to Rv0661c,len: 145 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 145 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv2863|MTV003.09|MTV003_7 (126 aa), FASTA scores: E(): 0.00087, (30.4% identity in 125 aa overlap),Rv0749|MTV041.23 (163 aa); Rv0277c, Rv2530c, etc. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 757104 | 757541 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0680c|vapc7
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Bibliography
No article yet recorded