Gene Mb0702
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s7 rpsg |
Comments | Mb0702, rpsG, len: 156 aa. Equivalent to Rv0683,len: 156 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 156 aa overlap). Probable rpsG, 30S ribosomal protein S7 (see citation below), equivalent to others from Mycobacteria e.g. P41193|RS7_MYCSM 30S RIBOSOMAL PROTEIN S7 from Mycobacterium smegmatis (156 aa), FASTA scores: opt: 986, E(): 0, (96.2% identity in 156 aa overlap); Q53539|RS7_MYCBO 30S RIBOSOMAL PROTEIN S7 from Mycobacterium bovis (156 aa); etc. Also highly similar to others e.g. Q9L0K4|RS7_STRCO 30S RIBOSOMAL PROTEIN S7 from Streptomyces coelicolor (156 aa); etc. Contains PS00052 Ribosomal protein S7 signature. BELONGS TO THE S7P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 783703 | 784173 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0702|rpsG MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW
Bibliography
No article yet recorded