Gene Mb0723
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l23 rplw |
Comments | Mb0723, rplW, len: 100 aa. Equivalent to Rv0703,len: 100 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 100 aa overlap). Probable rplW, 50S ribosomal protein L23, equivalent to O06046|RL23_MYCBO 50S RIBOSOMAL PROTEIN L23 from Mycobacterium bovis BCG (100 aa); and MLCB2492_4 50S RIBOSOMAL PROTEIN L23 from Mycobacterium leprae (100 aa). Also highly similar to others e.g. CAB82072.1|AL161803 50S ribosomal protein L23 from Streptomyces coelicolor (139 aa) (N-terminus longer); P04454|RL23_BACST 50s ribosomal protein L23 from Bacillus stearothermophilus (95 aa), FASTA scores: opt: 275, E(): 1.4e-13, (50.5% identity in 95 aa overlap); etc. Contains PS00050 Ribosomal protein L23 signature. BELONGS TO THE L23P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 803901 | 804203 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0723|rplW MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIAVEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA
Bibliography
No article yet recorded