Gene Mb0726
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l22 rplv |
Comments | Mb0726, rplV, len: 197 aa. Equivalent to Rv0706,len: 197 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 197 aa overlap). Probable rplV, 50S ribosomal protein L22, equivalent to O06115|RL22_MYCSM 50S RIBOSOMAL PROTEIN L22 from Mycobacterium smegmatis (153 aa); MBS10OPER_7 50S RIBOSOMAL PROTEIN L22 from Mycobacterium bovis BCG; and MLCB2492_7 50S ribosomal protein L22 from Mycobacterium leprae (175 aa). Also highly similar to others e.g. CAB82075.1|AL161803 50S ribosomal protein L22 from Streptomyces coelicolor (125 aa); P42060|RL22_BACSU 50s ribosomal protein L22 from Bacillus subtilis (113 aa), FASTA scores: opt: 368, E(): 2.4e-13, (52.8% identity in 108 aa overlap); etc. Contains PS00464 Ribosomal protein L22 signature, and contains repetitive sequence at C-terminus. BELONGS TO THE L22P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 805511 | 806104 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0726|rplV MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD
Bibliography
No article yet recorded