Gene Mb0726 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | 50s ribosomal protein l22 rplv | 
| Comments | Mb0726, rplV, len: 197 aa. Equivalent to Rv0706,len: 197 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 197 aa overlap). Probable rplV, 50S ribosomal protein L22, equivalent to O06115|RL22_MYCSM 50S RIBOSOMAL PROTEIN L22 from Mycobacterium smegmatis (153 aa); MBS10OPER_7 50S RIBOSOMAL PROTEIN L22 from Mycobacterium bovis BCG; and MLCB2492_7 50S ribosomal protein L22 from Mycobacterium leprae (175 aa). Also highly similar to others e.g. CAB82075.1|AL161803 50S ribosomal protein L22 from Streptomyces coelicolor (125 aa); P42060|RL22_BACSU 50s ribosomal protein L22 from Bacillus subtilis (113 aa), FASTA scores: opt: 368, E(): 2.4e-13, (52.8% identity in 108 aa overlap); etc. Contains PS00464 Ribosomal protein L22 signature, and contains repetitive sequence at C-terminus. BELONGS TO THE L22P FAMILY OF RIBOSOMAL PROTEINS. | 
| Functional category | Information pathways | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 805511 | 806104 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0726|rplV
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD
      
    Bibliography
    No article yet recorded