Gene Mb0727
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s3 rpsc |
Comments | Mb0727, rpsC, len: 274 aa. Equivalent to Rv0707,len: 274 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 274 aa overlap). Probable rpsC, 30S ribosomal protein S3, equivalent to O06048|RS3_MYCBO|MBS10OPER_8 30S RIBOSOMAL PROTEIN S3 from Mycobacterium bovis BCG (274 aa); and MLCB2492_8 30S RIBOSOMAL PROTEIN S3 from Mycobacterium leprae (281 aa). Also highly similar to others e.g. CAB82076.1|AL161803 30S ribosomal protein S3 from Streptomyces coelicolor (277 aa); P21465|RS3_BACSU 30s ribosomal protein s3 (bs3) (bs2) from Bacillus subtilis (217 aa), FASTA scores: opt: 794,E(): 0, (52.8% identity in 212 aa overlap); etc. BELONGS TO THE S3P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 806104 | 806928 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0727|rpsC MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSGLERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES
Bibliography
No article yet recorded