Gene Mb0728
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l16 rplp |
Comments | Mb0728, rplP, len: 138 aa. Equivalent to Rv0708,len: 138 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 138 aa overlap). Probable rplP, 50S ribosomal protein L16, equivalent to O06049|RL16_MYCBO|MBS10OPER_9 50S RIBOSOMAL PROTEIN L16 from Mycobacterium bovis BCG (138 aa); and MLCB2492_9 50S RIBOSOMAL PROTEIN L16 from Mycobacterium leprae (138 aa). Also highly similar to others e.g. CAB82077.1|AL161803 50S ribosomal protein L16 from Streptomyces coelicolor (139 aa); P14577|RL16_BACSU 50s ribosomal protein l16 from Bacillus subtilis (144 aa), FASTA scores: opt: 600, E(): 0, (63.2% identity in 136 aa overlap); etc. Contains PS00701 Ribosomal protein L16 signature 2. BELONGS TO THE L16P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 806932 | 807348 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0728|rplP MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF
Bibliography
No article yet recorded