Gene Mb0729
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l29 rpmc |
Comments | Mb0729, rpmC, len: 77 aa. Equivalent to Rv0709,len: 77 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 77 aa overlap). Probable rpmC, 50S ribosomal protein L29, equivalent to O06050|RL29_MYCBO|MBS10OPER_10 50S RIBOSOMAL PROTEIN L29 from Mycobacterium bovis BCG (75 aa); and O32989|RL29_MYCLE|MLCB2492_10 50S RIBOSOMAL PROTEIN L29 from Mycobacterium leprae (80 aa). Also highly similar to others e.g. Q9L0D2|RL29_STRCO 50S RIBOSOMAL PROTEIN L29 from Streptomyces coelicolor (74 aa); P12873|RL29_BACSU 50s ribosomal protein l29 from Bacillus subtilis (66 aa),FASTA scores: opt: 225, E(): 8.3e-11, (58.6% identity in 58 aa overlap); etc. BELONGS TO THE L29P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 807348 | 807581 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0729|rpmC MAVGVSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNRRLRTVRQEIARIYTVLRERELGLATGPDGKES
Bibliography
No article yet recorded