Gene Mb0735
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l14 rpln |
| Comments | Mb0735, rplN, len: 122 aa. Equivalent to Rv0714,len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 122 aa overlap). Probable rplN, 50S ribosomal protein L14, equivalent to O32993|MLCB2492_14|ML1849|RL14_MYCLE 50S RIBOSOMAL PROTEIN L14 from Mycobacterium leprae (122 aa). Also highly similar to others e.g. CAB82080.1|AL161803 50S ribosomal protein L14 from Streptomyces coelicolor (122 aa); P33100|RL14_MICLU 50s ribosomal protein L14 from Micrococcus luteus (122 aa), FASTA scores: opt: 674, E(): 0, (85.2% identity in 122 aa overlap); etc. Contains PS00049 Ribosomal protein L14 signature. BELONGS TO THE L14P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 813195 | 813563 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0735|rplN
MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREKRFMKIISLAPEVL
Bibliography
No article yet recorded