Gene Mb0740
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l6 rplf |
| Comments | Mb0740, rplF, len: 179 aa. Equivalent to Rv0719,len: 179 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 179 aa overlap). Probable rplF, 50S ribosomal protein L6, equivalent to O32998|MLCB2492_19 50S RIBOSOMAL PROTEIN L6 from Mycobacterium leprae (179 aa). Also highly similar to others e.g. P46786|RL6_STRCO|CAB82085.1|AL161803|SCD31.42 50S ribosomal protein L6 from Streptomyces coelicolor (179 aa), FASTA scores: opt: 872, E(): 0, (70.4% identity in 179 aa overlap); etc. Contains PS00525 Ribosomal protein L6 signature 1. BELONGS TO THE L6P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 815220 | 815759 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0740|rplF
MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK
Bibliography
No article yet recorded