Gene Mb0754
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | adenylate kinase adk (atp-amp transphosphorylase) |
| Comments | Mb0754, adk, len: 181 aa. Equivalent to Rv0733,len: 181 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 181 aa overlap). Probable adk,adenylate kinase (ATP-AMP transphosphorylase) (EC 2.7.4.3), equivalent to Z98756|MLCB24 92_28 probable adenylate kinase from Mycobacterium leprae (181 aa), FASTA scores: opt: 978, E(): 0, (83.6% identity in 177 aa overlap); and AAF86323.1|AF271342 putative adenylate kinase from Mycobacterium marinum (124 aa) (N-terminus shorter). Also highly similar to others e.g. P43414|KAD_STRCO ADENYLATE KINASE from Streptomyces coelicolor (217 aa), FASTA score: (43.0% identity in 186 aa overlap); etc. Contains PS00113 Adenylate kinase signature. BELONGS TO THE ADENYLATE KINASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 827944 | 828489 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0754|adk
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Bibliography
No article yet recorded