Gene Mb0761
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb0761, -, len: 175 aa. Equivalent to Rv0740, len: 175 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 175 aa overlap). Conserved hypothetical protein; C-terminus (possibly part of truncated IS1557) shows nearly perfect identity to Rv0750|MTV041_24 (81 aa), FASTA score: (92.6% identity in 81 aa overlap). Also shows weak similarity to MTV007_5 hypothetical protein from Mycobacterium tuberculosis (313 aa), FASTA score: (34.5% identity in 110 aa overlap); and MLCL536_27 hypothetical protein from Mycobacterium leprae (315 aa), FASTA score: (34.5% identity in 84 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 833600 | 834127 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0761|Mb0761
MLPKNTRPTSETAEEFWDNSLWCSWGDRETGYTRTVTVSICQVADGEREAEGVRDMMRLECPAGLDLRTPNPEAYEITGQRPGEFVFVLGYLGHVRAIVGNCYIEIMPMGTRVELSKLADVALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG
Bibliography
No article yet recorded