Gene Mb0763
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe-pgrs family protein pe_pgrs8 |
Comments | Mb0763, PE_PGRS8, len: 172 aa. Equivalent to Rv0742, len: 172 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 172 aa overlap). Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, similar to many M. tuberculosis PGRS-type proteins e.g. Z78020|MTCY1A11_25 (498 aa), FASTA scores: opt: 766, E(): 6.1e-25, (73.6% identity in 178 aa overlap). Similarity suggests ORF starts with ATA start codon. |
Functional category | Pe/ppe |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 834814 | 835332 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0763|PE_PGRS8 MIAAPEAIAAAATDLASIGSTIGAANAAAAANTTAVLAAGADQVSVAIAAAFGAHGQAYQALSAQAATFHIQFVQALTAGAGSYAAAEAASAASITSPLLDAINAPFLAALGRPLIGNGADGAPGTGAAGGAGGLLFGNGGAGGSGAPGGAGGLLFGNGGAGGPGASGGALG
Bibliography
No article yet recorded