Gene Mb0770
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc31. contains pin domain. |
| Comments | Mb0770, -, len: 142 aa. Equivalent to Rv0749, len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Conserved hypothetical protein, similar to other hypothetical proteins from Mycobacterium tuberculosis e.g. Rv0749,Rv0277c, Rv2530c, etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 843418 | 843846 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0770|vapc31
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHLPTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Bibliography
No article yet recorded