Gene Mb0783c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0783c, -, len: 139 aa. Equivalent to Rv0760c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Conserved hypothetical protein, similar to N-terminal part of Rv2042c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (265 aa), FASTA scores: opt: 150, E(): 4.1e-05, (28.7% identity in 136 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 856456 | 856875 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0783c|Mb0783c
MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGNQE
Bibliography
No article yet recorded