Gene Mb0786c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE FERREDOXIN |
| Comments | Mb0786c, -, len: 68 aa. Equivalent to Rv0763c, len: 68 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 68 aa overlap). Possible ferredoxin,similar to others and related proteins e.g. P18324|FER1_STRGO|SUAB ferredoxin 1 (fd-1) from Streptomyces griseolus (68 aa); AAK31349.1|AF350429_2|AF350429 putative ferredoxin from Nocardioides sp (63 aa); AAK16536.1|AF331043_16|AF331043 phthalate dioxygenase ferredoxin subunit from Arthrobacter keyseri (64 aa); etc. Probably involved in electron transport for cytochrome P-450 system e.g. downstream ORF Rv0764c|MTCY369.09c PROBABLE CYTOCHROME P450 51 from Mycobacterium tuberculosis (451 aa), FASTA scores: opt: 137, E(): 0.00013, (36.4% identity in 66 aa overlap). Also similar to putative ferredoxins Rv3503c and Rv1786 from Mycobacterium tuberculosis. COULD BELONG TO THE BACTERIAL TYPE FERREDOXIN FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 858662 | 858868 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0786c|Mb0786c
MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE
Bibliography
No article yet recorded