Gene Mb0808
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN [SECOND PART] |
| Comments | Mb0808, -, len: 368 aa. Equivalent to 3' end of Rv0785, len: 566 aa, from Mycobacterium tuberculosis strain H37Rv, (99.7% identity in 368 aa overlap). Conserved hypothetical protein, highly similar to other conserved hypothetical proteins e.g. NP_105777.1| NC_002678 hypothetical protein from Mesorhizobium loti (552 aa); SC5F8.14|CAB93742.1|AL357613 conserved hypothetical protein from Streptomyces coelicolor (557 aa); AE001863|AE001863_31 from Deinococcus radiodurans (554 aa), FASTA scores: opt: 2243, E(): 0, (61.1% identity in 550 aa overlap); YEF7_YEAST|P32614 hypothetical 50.8 kd protein (470 aa), FASTA scores: opt: 169, E(): 0.0014,(23.8% identity in 542 aa overlap); etc. Also similar to Rv1817|MTCY1A11.26c from Mycobacterium tuberculosis (487 aa), FASTA score: (26.7% identity in 587 aa overlap). And shows similarity with other dehydrogenases. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv0785 exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base deletion (t-*), splits Mb0807 into 2 parts, Mb0807 and Mb0808. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 882124 | 883230 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0808|Mb0808
MTGVRGTVLEPSDEPRGAPSSRKSVGKFEFRASAVIVASGGIGGNHELVRKNWPRRMGRIPKQLLSGVPAHVDGRMIGIAQKAGAAVINPDRMWHYTEGITNYDPIWPRHGIRIIPGPSSLWLDAAGKRLPVPLFPGFDTLGTLEYITKSGHDYTWFVLNAKIIEKEFALSGQEQNPDLTGRRLGQLLRSRAHAGPPGPVQAFIDRGVDFVHANSLRELVAAMNELPDVVPLDYETVAAAVTARDREVVNKYSKDGQITAIRAARRYRGDRFGRVVAPHRLTDPKAGPLIAVKLHILTRKTLGGIETDLDARVLKADGTPLAGLYAAGEVAGFGGGGVHGYRALEGTFLGGCIFSGRAAGRGAAEDIR
Bibliography
No article yet recorded