Gene Mb0809c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0809c, -, len: 212 aa, equivalent to hypothetical protein MT0810 from Mycobacterium tuberculosis strain CDC1551, len: 212 aa (100% identity with 212 aa overlap). Mb0809c transcript and transcriptional start site identified in Mycobacterium bovis strain AF2122/97 grown under exponential conditions. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 883265 | 883903 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0809c|Mb0809c
MQLTHFGHSCLLAEFGQTRLLFDPGTFSHGFEGITGLSAILITHQHPDHIDVTRLPTLLEDNPAAELYADPQTAAQLGEPWRAVHVGDELPLAELTVRAVGGCHAVIHPEIPVIENISYLVGDSKHRARLMHPGDALFVPGEQVDVLATPAAAPWMKISEAVDYLRAVAPARAVPIHQAIVAPDARGIYYGRLTEMTTTDFQVLPEESAVTF
Bibliography
No article yet recorded