Gene Mb0824
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0824, -, len: 115 aa. Equivalent to Rv0801, len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 115 aa overlap). Conserved hypothetical protein, similar to many hypothetical proteins from Streptomyces sp. e.g. SCD840A.20|AB81865.1|AL161691 hypothetical protein from Streptomyces coelicolor (145 aa); AF072709|AF072709_8 from Streptomyces lividans (131 aa), FASTA scores: opt: 120,E(): 0.2, (26.3% identity in 118 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 895461 | 895808 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0824|Mb0824
MALKVEMVTFDCSDPAKLAGWWAEQFDGTTRELLPGEFVVVARTDGPRLGFQKVPDPAPGKNRVHLDFTTKDLDAEVLRLVAAGASEVGRHQVGESFRWVVLADPEGNAFCVAGQ
Bibliography
No article yet recorded