Gene Mb0855
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe-pgrs family protein pe_pgrs12 |
Comments | Mb0855, PE_PGRS12, len: 137 aa. Equivalent to Rv0832, len: 137 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 137 aa overlap). Member of the Mycobacterium tuberculosis PE family, possibly PGRS subfamily of gly-rich proteins, highly similar to many others e.g. MTCY1A11.25c|Z78020 (498 aa), FASTA scores: opt: 529, E(): 5.2e-22, (61.8% identity in 136 aa overlap); etc. Appears to have incurred frameshift as next ORF should be continuation; sequence has been checked but no error found. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 925781 | 926194 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0855|PE_PGRS12 MSYVSVLPATLATAATEVARIGSALSLASAVAAAQTSAVQAAAADEVSAAIAALFSAHGRDFQALSARAAAFHHEFVQALAAGAGSYAVAEIAAASPLQSLIDVFNAPIQAATGRPLIGNGANGQPGTGAPGGPAGG
Bibliography
No article yet recorded