Gene Mb0874c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable short-chain type dehydrogenase/reductase |
Comments | Mb0874c, -, len: 275 aa. Equivalent to Rv0851c,len: 275 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 275 aa overlap). Probable short-chain dehydrogenase/reductase (EC 1.-.-.-), similar to many e.g. Q01198|LIGD_PSEPA C ALPHA-DEHYDROGENASE (EC 1.1.1.-)(SDR FAMILY) from Pseudomonas paucimobilis (Sphingomonas paucimobilis) (305 aa); D11473|PSELIG_1 C alpha-dehydrogenase from P. paucimobilis (305 aa), FASTA scores: opt: 468, E(): 4.9e-23, (30.8% identity in 279 aa overlap); NP_421969.1|NC_002696 short chain dehydrogenase family protein from Caulobacter crescentus (278 aa); etc. Contains PS00061 Short-chain dehydrogenases/reductases family signature. BELONGS TO THE SHORT-CHAIN DEHYDROGENASES/REDUCTASES (SDR) FAMILY. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 948396 | 949223 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0874c|Mb0874c MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLLGHFDVVFSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGLVPNAGLGAYGVAKYGVVGLAETLAREVTADGIGVSVLCPMVVETNLVANSERIRGAACAQSSTTGSPGPLPLQDDNLGVDDIAQLTADAILANRLYVLPHAASRASIRRRFERIDRTFDEQAAEGWRH
Bibliography
No article yet recorded