Gene Mb0877
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0877, -, len: 147 aa. Equivalent to Rv0854, len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). Conserved hypothetical protein, similar to several hypothetical protein from Mycobacterium leprae e.g. NP_301674.1|NC_002677 (144 aa); NP_302683.1|NC_002677|Z95398|MLCL622.27c (156 aa), FASTA scores: opt: 193, E(): 1.6e-06, (24.6% identity in 134 aa overlap); NP_301218.1|NC_002677 (146 aa); MTCI28.04|Z97050 (184 aa), FASTA scores: opt: 171, E(): 5.8e-05, (21.5% identity in 135 aa overlap). Also similar to SC6G10.02c|T35511|AL049497|SC6G10_2 hypothetical protein from Streptomyces coelicolor (144 aa), FASTA scores: opt: 344, E(): 6.1e- 17, (37.6% identity in 141 aa overlap). And similar to many proteins from Mycobacterium tuberculosis e.g. downstreams ORFs Rv0856 and Rv0857,etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 951938 | 952381 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0877|Mb0877
MAIKESRDIVIEASPEEILDVIADFEAMTEWSPAHQSVEILETGDDGRPSKVKMKVKTAGITDEQVVAYSWTDRSVRWTLVSSTQQRSQDGKYELTPKGDNTLVQFEITVDPQVPLPGFVLKRAIKGTIDTATEALRSQVLKVKKGQ
Bibliography
No article yet recorded