Gene Mb0891c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE RESUSCITATION-PROMOTING FACTOR RPFA |
| Comments | Mb0891c, rpfA, len: 327 aa. Equivalent to Rv0867c,len: 407 aa, from Mycobacterium tuberculosis strain H37Rv,(). Possible rpfA, resuscitation-promoting factor (see citation below). N-terminus highly similar to N-terminal part (1-125 aa) of Z99494|MLCB57_3|NP_302417.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (174 aa), FASTA scores: opt: 785, E(): 1.8e-18, (63.0% identity in 200 aa overlap); and highly similar to C-terminus of NP_301299.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (375 aa); and middle part of NP_302360.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (157 aa). N-terminus also highly similar in part of three secreted proteins from Streptomyces coelicolor e.g. CAC09538.1|AL442120 putative secreted protein (244 aa). Regions highly similar to CAB76321.1|AL158060 putative membrane protein from Streptomyces coelicolor (121 aa); and middle part of CAB09664.1|Z96935 rpf from Micrococcus luteus (220 aa). Also highly similar in part to four resuscitation-promoting factors from Mycobacterium tuberculosis: Rv2450 (172 aa), Rv1009 (362 aa), Rv1884c (176 aa), and Rv2389c (154 aa). Contains a probable secretory signal sequence in N-terminus. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 240 bp deletion leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (327 aa versus 407 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 965012 | 965995 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0891c|rpfA
MSGRHRKPTTSNVSVAKIAFTGAVLGGGGIAMAAQATAATDGEWDQVARCESGGNWSINTGNGYLGGLQFTQSTWAAHGGGEFAPSAQLASREQQIAVGERVLATQGRGAWPVCGRGLSNATPREVLPASAAMDAPLDAAAVNGEPAPLAPPPADLAPPAPADLAPPAPADLAPPVELAVNDLPAPLGEPLPAAPAELAPPADLAPASADLAPPAPADLAPPAPAELAPPAPADLAPPAAVNEQTAPGDQPATAPGGPVGLATDLELPEPDPQPADAPPPGDVTEAPAETPQVSNIAYTKKLWQAIRAQDVCGNDALDSLAQPYVIG
Bibliography
No article yet recorded