Gene Mb0935
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0935, -, len: 257 aa. Equivalent to Rv0911, len: 257 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 257 aa overlap). Conserved hypothetical protein, showing similarity with hydroxylases and hypothetical proteins e.g. T35325 probable hydroxylase from Streptomyces coelicolor (265 aa); Q54242 hypothetical protein from Streptomyces, FASTA scores: opt: 372, E(): 8.8e-18, (32.0% identity in 256 aa overlap); AAD04716.1|U77891 doxorubicin biosynthesis enzyme DnrV from Streptomyces peucetius (275 aa); AAA63051.1|U15184 hypothetical protein from Mycobacterium leprae (94 aa); etc. Also similar to Rv0577 HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (261 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1015864 | 1016637 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0935|Mb0935
MPTRSSAPLGAPCWIDLTTSDVDRAQDFYGTVFGWAFESAGPDYGGYINAAKGGHPVAGLMANRPEFQSPDGWATYFHTVDIGATVAKLAAAGGSSCLDPMEVPGKGFMSLAVDPSGAAFGLWQPLQHHGFEVIGEAGSPVWHQLTTRDYRSVIDFYRQVFGWRTEQISDTDEFCYTTAWFDDQQLLGVMDGSSCLPEGVPSNWTIFFGAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPMGVVFNLSSLQA
Bibliography
No article yet recorded