Gene Mb0942
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb0942, -, len: 158 aa. Equivalent to Rv0918, len: 158 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 158 aa overlap). Conserved hypothetical protein, similar in part to Q50116 hypothetical protein from Mycobacterium leprae (44 aa), FASTA scores: opt: 132,E(): 0.0055, (65.6% identity in 32 aa overlap). Also some similarity in C-terminus with other hypothetical proteins e.g. NP_289961.1|NC_002655 hypothetical protein from Escherichia coli strain O157:H7 (94 aa); etc. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1024677 | 1025153 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0942|Mb0942 MHRAGAAVTANVWCRAGGIRMAPRPVIPVATQQRLRRQADRQSLGGSGLPALNCTPIRHTIDVMATKPERKTERLAARLTPEQDALIRRAAEAEGTDLTNFTVTAALAHARDVLADRRLFVLTDAAWTEFLAALDRPVSHKPRLEKLFAARSIFDTEG
Bibliography
No article yet recorded