Gene Mb0957
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PHOSPHATE-TRANSPORT PROTEIN ABC TRANSPORTER PSTBa [FIRST PART] |
| Comments | Mb0957, pstBa, len: 71 aa. Equivalent to the 5' end of Rv0933, len: 276 aa, from Mycobacterium tuberculosis strain H37Rv (98.4% identity in 64 aa overlap). pstB,phosphate-transport ATP-binding protein ABC transporter (see citations below), thermostable ATPase, highly similar to others e.g. NP_348334.1|NC_003030 ATPase component of ABC-type phosphate transport system from Clostridium acetobutylicum (249 aa); NP_212352.1|NC_001318 phosphate ABC transporter ATP-binding protein (pstB) from Borrelia burgdorferi (260 aa); NP_390375.1|NC_000964 phosphate ABC transporter (ATP-binding protein) from Bacillus subtilis (269 aa), FASTA scores: opt: 762, E(): 0, (47.7% identity in 243 aa overlap); etc. Also similar to other M. tuberculosis ABC transporters e.g. MTCY253.24, E(): 2.5e-15 and MTCY359.14c, E(): 3.4e-15. Contains PS00211 ABC transporters family signature, and PS00017 ATP/GTP-binding site motif A (P-loop). BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). Magnesium or calcium seem to have no influence on the functionality of this enzyme. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, pstB exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base insertion (*-t) splits pstB into 2 parts, pstBa and pstBb. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1041730 | 1041945 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0957|pstBa
MACERLGGQSGAADVDAAAPAMAAVNLTLGFAGKTVLDQVSMGFPARAVTSLMGPTGSGKTTFFAHPKPDE
Bibliography
No article yet recorded