Gene Mb0972c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable mycolyl transferase, pseudogene |
| Comments | Mb0972c, -, len: 76 aa. Equivalent to Rv0947c, len: 76 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 76 aa overlap). Probable mycolyl transferase pseudogene (EC 2.-.-.-), similar to part of P31953|A85C_MYCTU|fbpC2 antigen 85-c precursor (85c) (FIBRONECTIN-BINDING PROTEIN C) from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 213, E(): 2e-08,(69.6% identity in 46 aa overlap). |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1057767 | 1057997 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0972c|Mb0972c
MGGSFDRAARARRQLDNLVNVVAAGSTHRLMVPSRSMHRLIKVEFQGGGPHAWYLSDGILARDDYNGRDIHLPVFG
Bibliography
No article yet recorded