Gene Rv0947c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; thought to be involved in mycolic acid biosynthesis. |
| Product | Probable mycolyl transferase, pseudogene |
| Comments | Rv0947c, (MTCY10D7.27), len: 76 aa. Probable mycolyl transferase pseudogene, similar to part of P31953|A85C_MYCTU|fbpC2 antigen 85-c precursor (85c) (fibronectin-binding protein C) from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 213, E(): 2e-08, (69.6% identity in 46 aa overlap). |
| Functional category | Lipid metabolism |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1057300 | 1057530 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0947c|Rv0947c
MGGSFDRAARARRQLDNLVNVVAAGSTHRLMVPSRSMHRLIKVEFQGGGPHAWYLSDGILARDDYNGRDIHLPVFG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
